PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Spipo4G0087200
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Alismatales; Araceae; Lemnoideae; Spirodela
Family MYB
Protein Properties Length: 284aa    MW: 30343.1 Da    PI: 6.3066
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Spipo4G0087200genomeMIPS/IBISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding582.1e-181461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l+ +++q+G+++W++ ++  g+ R++k+c++rw +yl
   Spipo4G0087200 14 RGQWTPEEDNKLAAYIAQHGTRNWRLMPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding50.64.5e-1668110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++++E++ +v+++  lG++ W+ Ia+ ++ gRt++++k++w++
   Spipo4G0087200  68 GEFSEQEEQTIVKLHSVLGNR-WSVIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.6E-24564IPR009057Homeodomain-like
PROSITE profilePS5129418.458961IPR017930Myb domain
SuperFamilySSF466892.31E-2911108IPR009057Homeodomain-like
SMARTSM007172.1E-131363IPR001005SANT/Myb domain
PfamPF002491.0E-161461IPR001005SANT/Myb domain
CDDcd001671.66E-111761No hitNo description
PROSITE profilePS5129425.28762116IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.3E-2465116IPR009057Homeodomain-like
SMARTSM007174.6E-1566114IPR001005SANT/Myb domain
PfamPF002491.9E-1468110IPR001005SANT/Myb domain
CDDcd001679.47E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MGRVPCCERD NVKRGQWTPE EDNKLAAYIA QHGTRNWRLM PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGEF SEQEEQTIVK LHSVLGNRWS VIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKTFS HLIAEITSTL APPQMTHLAE AALGCFKDEV LHLLTRKRAD PGGAAGEALA  180
GLYPAAASRP ADGFGYGAPS FCDDAERSAW SQSVCTSATC EGAAAAGPAG TRGEGSACVK  240
GEEEAGEETR SGGVAEGEGG AAAMFGADCI MWDLSDDLMD AIV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A1e-29141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010928123.11e-136PREDICTED: transcription factor MYB12
SwissprotQ7XQN11e-113MYB80_ORYSJ; Transcription factor MYB80
SwissprotQ9XHV01e-114MYB80_ARATH; Transcription factor MYB80
TrEMBLD7UAP51e-128D7UAP5_VITVI; Putative uncharacterized protein
STRINGVIT_19s0015g01280.t011e-127(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP108673339
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-113myb domain protein 103